Sign In | Join Free | My
Search by Category
Home > Chemicals > Petrochemical Products >

Sermorelin Acetate Side Effects

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type


    sermorelin acetate side effects

    All sermorelin acetate side effects wholesalers & sermorelin acetate side effects manufacturers come from members. We doesn't provide sermorelin acetate side effects products or service, please contact them directly and verify their companies info carefully.

    Total 9135 products from sermorelin acetate side effects Manufactures & Suppliers
    Quality LGRF 1-29 Sermorelin Acetate Peptides For Fat Loss And Muscle Gain CAS 86168-78-7 for sale

    Brand Name:YUANHANG

    Model Number:86168-78-7

    Place of Origin:CHINA

    ...Peptide Hormones Sermorelin 2mg/vial GRF 1-29 CAS 86168-78-7 For Weight Loss Sermorelin Acetate Sermorelin Properties alpha D20 -63.1° (c = 1 in 30% acetic acid) storage temp. −20°C Abstract Sermorelin (INN) (trade name is Geref), also...

    Yuanhang Bio-pharmaceutical Technology Co.,Ltd
    Verified Supplier


    Quality Pharmaceutical Powder Polypeptides For Muscle Building Sermorelin Acetate Hydrate for sale

    Brand Name:YIHAN

    Model Number:Sermorelin

    Place of Origin:hina

    ... Building Sermorelin Acetate Hydrate Quick detail Sermorelin 2mg (GRF 1-29) Peptide Molecular formula: C149H246N44O42S Molar Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: Sermorelin acetate hydrate, GRF 1-29 NH2 Sermorelin Acetate...

    Yihan Industrial Co.,Ltd.
    Verified Supplier


    Quality 99% Purity Anti-aging Bulking Cycle Human Peptides Sermorelin Acetate With 2mg/vial for Muscle Gainning for sale

    Brand Name:HongKong Blue

    Model Number:CAS No.: 86168-78-7

    Place of Origin:CHINA

    ...99% Purity Anti-aging Bulking Cycle Human Peptides Sermorelin Acetate With 2mg/vial for Muscle Gainning Welcome inquiry and order samples, special gift is ready ...

    HongKong Blue Universal Co., Limited.
    Verified Supplier


    Quality Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder for sale

    Brand Name:Sermorelin

    Model Number:87616-84-0

    Place of Origin:china

    ...Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder Introduction: GH-releasing peptides (GHRPs) are synthetic peptides that like GHRH ...

    Pharmlab Co.,Ltd
    Verified Supplier


    Quality White Powder Releasing Human Growth Peptides Sermorelin Acetate GRF 1-29 for sale

    Brand Name:Yuancheng

    Model Number:86168-78-7

    Place of Origin:WUHAN

    ... Peptide Sermorelin Acetate GRF 1-29 Product Name:Sermorelin Acetate,GRF 1-29 Alias:Somatoliberin,Sermorelin ,Sermorelinum,Sermorelina,Sermoreline CAS No.: 86168-78-7 Molecular Formula: C149H246N44O42S Sermorelin Molecular Weight: 3357.96 Sermorelin Purity...

    Hangzhou Fuluo Biological Technology Co.,Ltd.
    Verified Supplier


    Quality Sermorelin Acetate Bodybuilding , Growth Hormone Peptides Sample Available for sale

    Brand Name:HBYC

    Model Number:HBYC

    Place of Origin:China

    ...High Purity and 2016 Newly Produced Sermorelin Improving Sleep Basic Info Port: China Production Capacity: 1000vial/Week Payment Terms:T/T, Western Union, Money ...

    Hongkong YuanCheng GongChuang Technology Co.,Ltd
    Verified Supplier

    Quality Sermorelin Acetate Human Growth Hormone Peptide For Improving Sleep Quality for sale

    Brand Name:Yihan

    Place of Origin:China

    Model Number:86168-78-7

    ...Bodybuilding Peptides Sermorelin Acetate 2mg/vial Human Growth Hormones For Fat Loss Description Sermorelin is a GHRH (growth hormone-releasing hormone) peptide analogue. Its peptide sequence is comprised of 29 ...

    Yihan Industrial Co.,Ltd.
    Verified Supplier


    Quality Sermorelin Acetate Local Anesthetic Powder CAS 86168-78-7 White Powder for sale

    Brand Name:Top Pharm

    Model Number:86168-78-7

    Place of Origin:China

    ...Peptides Sermorelin Acetate Cas No.86168-78-7 white powder Peptide series hot sell 2mg/vial Product Name Sermorelin Acetate Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu...

    Verified Supplier

    Quality Effective Standard Mestanolone Testosterone Powder Source For Male Hypogonadism Treatment for sale

    Brand Name:TJ

    Model Number:521-11-9

    Place of Origin:CHINA

    ...: White Crystalline Powder Assay: 99% Effective Standard Mestanolone Testosterone Powder Source For Male Hypogonadism Treatment 99% Purity Mestanolone Hormone 99.37% Male Sex Hormone Powder Mestanolone Acetate (CAS No.: 521-11-9) 99...

    zhuhai TianJian Chemical Co.,Ltd.
    Verified Supplier


    Quality Finaplix H / Revalor-H Trenbolone Acetate Trenbolone Raw Steroid Powder Shipping Guaranteed for sale

    Brand Name:TINGYI

    Model Number:10161-34-9

    Place of Origin:China

    ... Step Guide For Making Tren Ace 100 Oil. The recipe for 1000 ml of trenbolone acetate @ 100 mg/ml we use: powders: 100 grams; BA: 2%, 20 ML BB: 10%, 100 ML...

    Chongqing Tingyi Biotechnology Co.,Ltd
    Verified Supplier


    Quality Sermorelin Acetate CAS 86168-78-7 Polypeptides Pharmaceutical Hormone for Body Building for sale

    Brand Name:SD

    Model Number:99%

    Place of Origin:shenzhen,china

    ...Product Description Quick Details of Sermorelin Product name Sermorelin Other Name SERMORELIN;SERMORELIN ACETATE;GH RELEASING FACTOR (1-29), AMIDE, GRF (1-29) NH2 Original China CAS 86168-78-7 Molecular formula ...

    Shenzhen Sendi Biotechnology Co.Ltd.
    Active Member


    Quality Injectable Growth Hormone Muscle Buildig Peptides  Sermorelin Acetate 2mg/vial for sale

    Brand Name:Shuangbojie

    Model Number:Sermorelin Acetate

    Place of Origin:China

    ... Hormone Sermorelin 2mg Sermorelin Acetate Sermorelin acetate is a human growth hormone-releasing hormone (GHRH or GRF) used for diagnostic evaluation of pituitary function and also for increasing growth in children. Off label usage of sermorelin acetate...

    Zhuhaishi Shuangbojie Technology Co., Ltd
    Active Member


    Quality Sermorelin Acetate Powder for sale

    Place of Origin:China

    ... purity Atosiban Acetate Deslorelin Acetate Desmopressin Acetate Gonadorelin Acetate/GnRH Leuprorelin Acetate Melanotan ② Octreotide Acetate Oxytocin Acetate Salmon Calcitonin Sermorelin Acetate Teriparetide Acetate Triptorelin Acetate Thymosinβ4(human...

    Wuhan changdashun Technology Co., Ltd
    Site Member


    Quality Manufacture fresh stock Sermorelin Acetate with competitve price anf quality guarantee for sale

    Brand Name:Youngshe

    Model Number:YSPI

    Place of Origin:Chengdu , China

    ...Product Description Name: Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(acetate) Formula: C151H250N44O44S Molecular:3417 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Appearance: white powder Source: synthetic Also known ...

    Chengdu Youngshe Chemical Company
    Active Member

    Quality Sermorelin Acetate for sale

    Brand Name:YC

    Place of Origin:wuhan china

    ...Product Name Sermorelin Acetate Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-...

    Wuhan Yuancheng Gongchuang Technology Co.,Ltd
    Active Member


    Quality High Purity Raw Powder Sermorelin Acetate Peptide for Weight Loss CAS:86168-78-7 for sale

    Brand Name:JNJG

    Model Number:86168-78-7

    Place of Origin:CHINA

    ...Specification: Product Name Sermorelin Sermorelin CAS 86168-78-7 Sermorelin Alias Sermorelin Acetate Sermorelin Molecular Formula C149H246N44O42S Sermorelin Molecular weight 3357.96 Specification 2mg/vial Apperance white powder Assay 98% Storage 2-8 degree...

    Jinan  Jiage  Biological Technology Co.,Ltd
    Active Member


    Quality Anabolic Steroids Sermorelin Bodybuilding , Sermorelin Acetate 2mg White Powder Peptide for sale

    Place of Origin:China

    ...Anabolic Steroids Sermorelin Bodybuilding Sermorelin Acetate 2mg White Powder Peptide Product Data: Product name: Sermorelin Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-...

    Shenzhen Ghormone Biotech Co.,Ltd
    Active Member


    Quality Sermorelin Acetate Hydrate Increase Human Growth Hormone In Sport GHRH for sale

    Brand Name:KANGDISEN

    Model Number:2 mg/vial

    Place of Origin:China

    ... In Sport GHRH Sermorelin Sermorelin Acetate, also known as GRF 1-29, is a Growth Hormone Releasing Hormone (GHRP) produced by the brain that stimulates the production and release of Growth Hormone (GH). Sermorelin Acetate was first...

    Hongkong Kangdisen Medical Co., Limited
    Active Member

    Hong Kong

    Quality Sermorelin GRF 1-29 Human Growth Hormone Sermorelin Acetate for weight loss for sale

    Brand Name:steriodshow

    Model Number:86168-78-7

    Place of Origin:china manufactuer

    ... Molecular formula: C149H246N44O42S Molar Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: Sermorelin acetate hydrate, GRF 1-29 NH2 Sermorelin Acetate 2. Description:

    Zhuhaishi Shuangbojie Technology Co.,ltd
    Active Member


    Quality 2MG / Vial Sermorelin Acetate Cas 86168-78-7 White Lyophilized Powder for sale

    Brand Name:Zhenxiang

    Model Number:CAS: 86168-78-7

    Place of Origin:CHINA

    ...2mg/vial Sermorelin Acetate CAS: 86168-78-7 Peptide Steroid Hormones White Lyophilized Powder Quick Detail; Alias:Sermorelin Acetate Hydrate CAS: 86168-78-7 MF: C149H246N44O42S MW: 3357.96 Purity: 99% Specification: 2mg/vial Appearance: ...

    Changsha Zhenxiang Biotechnology Co., Ltd.
    Active Member


    Inquiry Cart 0