Sign In | Join Free | My brakesband.com
brakesband.com
Products
Search by Category
Home > Chemicals > Explosive >

Peptide Igf 1 Lr3

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    peptide igf 1 lr3

    All peptide igf 1 lr3 wholesalers & peptide igf 1 lr3 manufacturers come from members. We doesn't provide peptide igf 1 lr3 products or service, please contact them directly and verify their companies info carefully.

    Total 2235 products from peptide igf 1 lr3 Manufactures & Suppliers
    Quality Injection Hormone Human Growth Peptides Igf lr3 CAS 946870-92-4 for Hospital for sale

    Brand Name:Gear Steroids

    Model Number:946870-92-4

    Place of Origin:CHINA

    ...Injection Hormone Peptide Igf lr3 CAS 946870-92-4 for Hospital for Muscle Growth 1, Basic Information Model NO.: CAS 946870-92-4 ...

    Shanghai Rong Can Science And Technology Co., Ltd.
    Verified Supplier

    Shanghai

    Quality Injectable Human Growth Hormone Peptide IGF LR3-1 1000mcg / Vial Long-R3 Igtropin for sale

    Brand Name:Bodybiological

    Place of Origin:Hubei, China

    ...Injectable Human Growth Hormone Peptide IGF lR3-1 1000mcg/vial Long-R3 for Fatness Basic information: Product Name: IGTROPIN /IGF-1 lr3 Manufacturer: GenSci Laboratories, China. Substance: Insuline-like Growth Factor Package: 1000mcg/vial * 10vials/kit The...

    Wuhan Body Biological Co.,Ltd
    Verified Supplier

    Hubei

    Quality Human Peptides IGF Lr3 For Greatly Boosts Muscle Mass 946870-92-4 for sale

    Brand Name:Hongkong Blue Universal

    Model Number:946870-92-4

    Place of Origin:China

    ... Peptides IGF Lr3 For Greatly Boosts Muscle Mass 946870-92-4 IGF --- Insulin-Like Growth Factors What is IGF1-LR3 ? IGF-1 is basically a polypeptide hormone that has the same some of the same molecular properties as insulin. IGF...

    HongKong Blue Universal Co., Limited.
    Verified Supplier

    Hongkong

    Quality IGF-LR3 1mg/vial Anti-aging Fat Loss IGF LR3 Peptides HGH Growth Hormone Supplements Wrinkle Remover for Women for sale

    Brand Name:YC

    Model Number:CAS: 125-69-9

    Place of Origin:China

    ...IGF-LR3 Anti-aging Fat Loss IGF LR3 HGH Growth Hormone Supplements Wrinkle Remover for Women IGF-1Lr3 1mg/vial,10vials/kit 0.1mg/vial,10vials/kit 1. Payment & Shipping Terms: Packaging Details: Discreet ...

    Hangzhou Fuluo Biological Technology Co.,Ltd.
    Verified Supplier

    Zhejiang

    Quality GMP Lab Supply High Quality Igf-1 lr3 peptide IGF-1 LR3 for Muscle Growth for sale

    Brand Name:Zhenxiang

    Model Number:946870-92-4

    Place of Origin:CHINA

    ...99% Purity IGF-1 lr3 the Anabolic Powerhouse for Bodybuilding Email: ling@chembj.com Skype: ling@chembj.com Whatsapp: 0086 181 0845 9329 What is IGF1-LR3 IGF-1 is basically a polypeptide hormone that has the...

    Changsha Zhenxiang Biotechnology Co., Ltd.
    Verified Supplier

    Hunan

    Quality Injection Hormone Human Growth Peptides IGF-1 LR3 1mg/vial for Muscle Building and Anti-Aging for sale

    Brand Name:Pharmlab

    Model Number:946870-92-4

    Place of Origin:China

    ...Injection Hormone Human Growth Peptides IGF-1 LR3 1mg/vial for Muscle Building and Anti-Aging Quick Details : Product name:IGF-1 LR3 CAS No.:946870-92-4 Purity:.98%min Appearance:White powder Storage:Dry Cool Place...

    Pharmlab Co.,Ltd
    Verified Supplier

    Hubei

    Quality White Powder Muscle Building Peptides IGF1- LR3 For Bulking Muscle for sale

    Brand Name:ChineseHormone

    Model Number:129954-34-3

    Place of Origin:China

    ... IGF's. IGF-1 LR3 comprises a family of peptides (protiens) that play important roles in mammalian growth and development. IGF1 LR3 is also known as Long R3 IGF-1 or Insulin-Like Growth Factor-I Long Arg3. The Long R3 IGF...

    HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
    Verified Supplier

    Hong Kong

    Quality IGF LR3 -1Growth Hormone Peptide Igf-1Lr3 Igf Lr CAS 946870-92-4 For Lean Muscles / Recovery for sale

    Brand Name:IGF LR3 -1

    Model Number:IGF LR3 -1

    Place of Origin:China

    ...IGF LR3 -1Growth Hormone Peptide Igf-1Lr3 Igf Lr CAS 946870-92-4 For Lean Muscles / Recovery IGF LR3 Description IGF-1 is basically a polypeptide hormone that has the same some of the same molecular properties as insulin. IGF dose actually...

    JCJ Logis Co.,ltd
    Verified Supplier

    Hubei

    Quality Human Growth Hormone Peptides IGF-1 LR3 0.1 mg/vial CAS 946870-92-4 For Good Body Shape for sale

    Brand Name:YUANYANG

    Model Number:946870-92-4

    Place of Origin:China

    ...Human Growth Hormone Peptides IGF-1 LR3 0.1 mg/vial CAS 946870-92-4 For Good Body Shape Abstract IGF-1Lr3 is basically a polypeptide hormone that has the same some of the same molecular properties ...

    Zhongshan Yuanyang Bio-pharmaceutical Technology Co.,Ltd
    Verified Supplier

    Guangdong

    Quality GMP Body Protection Compound Muscle Growth Hormone Peptides IGF -1 DES 1mg / vial for sale

    Brand Name:Biopro

    Model Number:GHP-37

    Place of Origin:China

    ...Hormone Peptides IGF -1 DES 1mg / vial Basic Info. Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA Molar Mass: 7,372 Da Synonyms: IGF-1Des(1-3), Des1-3, Des 1-3, Des (1-3) Compound: Thr-Leu-Cys-Gly-Ala. Purity: 99.21% IGF-1DES...

    Biopro Chemicals Co., Ltd.
    Verified Supplier

    Shanghai

    Quality Muscle Gain Peptides IGF 1 LR3 Growth Hormone Peptides Muscle Enhancing Steroid for sale

    Brand Name:Shanghai Stero

    Model Number:IGF

    Place of Origin:China

    ...Muscle Gain Peptides IGF 1 LR3 Growth Hormone Peptides Muscle Enhancing Steroid Description: IGF1 LR3 is known for being a growth hormone. It has plenty of growth promoting effects and it ...

    Shanghai Stero R&D Co,. Ltd
    Verified Supplier

    Shanghai

    Quality Bodybuilding Human Growth Peptides IGF-1 LR3 Insulin Like Growth Factor LONG R3 IGF-1 for sale

    Brand Name:huao

    Model Number:946870-92-4

    Place of Origin:China

    ...Bodybuilding Human Growth Peptides IGF-1 LR3 Insulin Like Growth Factor LONG R3 IGF-1 Basic Info. Product name: IGF-1Lr3 Synonyms: R3 IGF1, R3 IGF-1, R3IGF1, R3IGF-1, LONG IGF1, LONG IGF-1, LONG R3 IGF1, CAS No.: 946870-92...

    Guangzhou Huao Chemical Co.,Ltd
    Verified Supplier

    Guangdong

    Quality 1mg / Vial Research Chemicals Peptides , IGF 1 LR3  Peptides For Adult CAS 946870-92-4 for sale

    Brand Name:Muscle Man

    Model Number:CAS: 946870-92-4

    Place of Origin:China

    ...White Powder Research Peptides Igf-1 Lr3 Bodybuilding IGF-1 LR3 by Lab For Adult With GMP IGF-1 LR3 Quick Detail: Product name:IGF-1Lr3 CAS No.:946870-92-4 Purity:.98%min Appearance:White powder Storage:Dry Cool Place ...

    Zhuzhou Interial Biotechnology Co., Ltd
    Verified Supplier

    Hunan

    Quality 99% Injection Hormone Peptide IGF-1 LR3 CAS 946870-92-4 for Muscle Growth for sale

    Brand Name:Nanjian

    Model Number:946870-92-4

    Place of Origin:China

    ...Pharmaceutical grade 99% Injection Hormone Peptide IGF-1 LR3 CAS 946870-92-4 for Muscle Growth Basic Information Model NO.: CAS 946870-92-4 Customized: Customized ...

    Tai'an Jia Ye Biological Technology Co.,Ltd
    Verified Supplier

    Quality Long R3 IGF-1 Human Growth Hormone Peptides IGF-1 LR3 1mg/vial  For Bodybuilding for sale

    Brand Name:sendi

    Model Number:IGF-1 LR3

    Place of Origin:china

    ...Introduction: IGF-1 LR3 is an insulin growth factor and it is a human recombinant. It is also a single and ...

    Shenzhen Sendi Biotechnology Co.Ltd.
    Verified Supplier

    Guangdong

    Quality HGH Growth Hormone IGF LR3 Peptides 1mg / vial 0.1mg / vial Anti aging Fat Loss Wrinkle Remover for sale

    Brand Name:HKYC

    Model Number:946870-92-4

    Place of Origin:China

    ...HGH Growth Hormone IGF LR3 Peptides 1mg / vial 0.1mg / vial Anti aging Fat Loss Wrinkle Remover Quick Details Product name:IGF-1 LR3 CAS No.:946870-92-4 Purity:.98%min Appearance:White powder Storage:Dry Cool...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier

    Hong Kong

    Quality Amino Acid Peptides IGF-1 LR3 for Increased Biological Activity CAS 946870-92-4 for sale

    Brand Name:Skype: rdy705

    Model Number:ycwlb045@yccreate.com

    Place of Origin:China

    ...Amino Acid Peptides IGF-1 LR3 for Increased Biological Activity CAS 946870-92-4 WHAT IS IGF-1 LR3? IGF-1 LR3, also known as Long Arg3 IGF-1, is a recombinant protein analogue of human Insulin-Like Growth Factor-1 that has a molar mass...

    Zhuhaishi Shuangbojie Technology Co.,ltd
    Verified Supplier

    Guangdong

    Quality 99% Igf1 Original Igf-1lr3 1mg Growth Hormone Peptide Igf-1des (1-3) for sale

    Brand Name:JNJG

    Model Number:Igf-1lr3

    Place of Origin:CHINA

    ...! Delivery terms HKEMS,DHL,TNT,EMS,Fedex,UPS Payment Western Union, Money gram, T/T,Bitcoin Description: IGF-1Lr3 is basically a polypeptide hormone that has the same some of the same molecular properties...

    Jinan  Jiage  Biological Technology Co.,Ltd
    Verified Supplier

    Shandong

    Quality 98% HGH Growth Hormone IGF LR3 Peptide for Anti aging Fat Loss Wrinkle Remover 1mg 0.1mg for sale

    Brand Name:Muscle Man

    Model Number:ychz04@chembj.com

    Place of Origin:China

    ...98% HGH Growth Hormone IGF LR3 Peptide for Anti aging Fat Loss Wrinkle Remover 1mg 0.1mg 1. Product details IGF-1 LR3 CAS No.:946870-92-4 Purity:.98%min Appearance:White powder Storage:Dry Cool Place Grade...

    Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
    Verified Supplier

    Hunan

    Quality Injectable Human Growth Hormone Peptide IGF LR3-1 1000mcg / Vial Long-R3 Igtropin for sale

    Categories:Human Growth Hormone Peptide

    Telephone:27-8753-6729

    Country/Region:china

    ... Policy Purity: 99.8% Brand: Bodybiological Injectable Human Growth Hormone Peptide IGF lR3-1 1000mcg/vial Long-R3 for Fatness Basic information: Product Name: IGTROPIN /IGF-1 lr3 Manufacturer: GenSci Laboratories, China. Substance: Insuline-like Growth...

    Wuhan Body Biological Co.,Ltd
    ICP Remarked Supplier

    Hubei

    Inquiry Cart 0