Sign In | Join Free | My brakesband.com
brakesband.com
Products
Search by Category
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    hgh 191 side effects

    All hgh 191 side effects wholesalers & hgh 191 side effects manufacturers come from members. We doesn't provide hgh 191 side effects products or service, please contact them directly and verify their companies info carefully.

    Total 4715 products from hgh 191 side effects Manufactures & Suppliers
    Quality Medicine Grade Hygetropin Growth Hormone Powder Hgh Supplements Strong Effect for sale

    Brand Name:hygetropin

    Model Number:C16H22Cl2N2O

    Place of Origin:china

    ...Medicine Grade Hygetropin Growth Hormone Powder Hgh Supplements Strong Effect Skype: live:leercsupplier Skype name:RC supplier Email : rcbossboy@gmail.com Whatsapp :+86 17045275682 Wickr :...

    Shandong Chuangrui Chemical Technology Co., Ltd.
    Verified Supplier

    Shandong

    Quality Melanotan II Hgh Growth Hormone Injection Skin Tanning Sexual Neuropeptide for sale

    Brand Name:Diselbiotech

    Model Number:MT2

    Place of Origin:China

    Skin Tanning and Sexual Human neuropeptide Peptide Powder Melanotan II / Mt 2 for Good Effecgt Product Description Name: Melanotan II Acetate (MT-II) CAS No.: 121062-08-6 Molecular Formula: C50H71N15O10 Molecular Weight: 1042.1932 Property: White powder ...

    Wuhan Disel Biotechnology Co., Ltd.
    Verified Supplier

    Hubei

    Quality HGH powder injection 99.61% purity hygetropin Human Growth Hormone 10iu/ vial HCG jintropin Hgh for sale

    Brand Name:KUKE

    Model Number:CAS 12629-01-5

    Place of Origin:China

    ... injection 99.61% purity hygetropin Human Growth Hormone 10iu/ vial HCG jintropin Hgh Email : ella@shengrichem.com SKype : live:2871114886 WhatsApp: +8618266757067 Details Description : Product Name Human Growth ...

    Hubei KUKE Chemcial Co., Ltd
    Verified Supplier

    Hubei

    Quality 98% Min Purity HGH Growth Hormone , Muscle Building 36iu OEM Genotropin for sale

    Brand Name:Filter

    Place of Origin:China

    Model Number:API

    ... GMP From Lab (OEM) Growth hormone (GH) or somatotropin, also known as human growth hormone (hGH or HGH) in its human form, is a peptide hormone that stimulates growth, cell reproduction, and cell...

    Passion Technology Development Limited
    Verified Supplier

    Henan

    Quality Lyophilized Peptide Fat Burning Growth Hormone Peptides HGH Frament 176-191 CAS221231-10-3 for sale

    Brand Name:LSW

    Model Number:221231-10-3

    Place of Origin:CN

    ...High Quality Fat Burning Growth Hormone Peptides HGH Frament 176-191 CAS221231-10-3 Lyophilized Peptide Product Description Product name:HGH Frag 176-191 Synonyms: Fragment 177-191, AOD-9604 MF: C78H123N23O23S2 MW: 1815.08152 CAS...

    Wuhan Lianshangwang Technology Co.,Ltd
    Verified Supplier

    Hubei

    Quality Medical Peptide Protein Hormones Aod 9604 / Hgh Fragment 177 191 CAS 221231-10-3 for sale

    Brand Name:shinrezing

    Model Number:221231-10-3

    Place of Origin:China

    ...Product Description Frag 176-191 Synonyms: Fragment 177-191, AOD-9604 MF: C78H123N23O23S2 MW: 1815.08152 CAS:221231-10-3 Appearance: White Powder Purity: 99% ...

    Hubei Shinrezing Pharmaceutical Technology Co.,Ltd
    Verified Supplier

    Hubei

    Quality Fat Loss Growth Hormone Peptides , Peptides HGH Fragment 176-191 for sale

    Brand Name:Yuancheng

    Model Number:221231-10-3

    Place of Origin:Wuhan,Hubei

    ...Bodybuilding Fat loss Human Growth HGH176-191 Peptides HGH fragment 176- 191 Synonyms: Fragment 177-191, AOD-9604 MF: C78H123N23O23S2 MW: 1815.08152 CAS NO.: 221231-10-3 Appearance: White Powder Purity: ...

    Hangzhou Fuluo Biological Technology Co.,Ltd.
    Verified Supplier

    Zhejiang

    Quality High Quality Peptides Fat Loss Fragment 176-191 2mg/Vial 221231-10-3 for sale

    Brand Name:Peptide

    Model Number:221231-10-3

    Place of Origin:China

    ... Frag 176 191 Synonyms GH Fragment 176-191 CAS 221231-10-3 Purity 98% min Molecular formula C78H123N23O23S2 MW 1815.08152 Appearance White Powder Grade Pharmaceutical Grade Storage Lyophilized HGH FRAG 176-191 although stable...

    Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
    Verified Supplier

    Hubei

    Quality HGH 191AA Human Growth Hormone Steroid 99% Purity Powder For Weight Loss for sale

    Brand Name:Global Chemical

    Model Number:HGH 191AA Blue Tops

    Place of Origin:China

    ...99% Human Growth HGH 191AA Blue Tops Hormone HGH Powder for Weight Loss 191AA HGH reviews HGH 191AA CAS:9002-72-6 Feature: high bioactivity, high stability, high purity, 191 aa Molecular formula: C990H1528N262O300S7 Formula weight...

    Global chemicals Co.,Ltd
    Verified Supplier

    Quality CAS No 12629-01-5 Top Pure HGH Human Growth Hormone  Anti Aging Growth Hormone for sale

    Brand Name:SGH

    Model Number:CAS No: 12629-01-5

    Place of Origin:China

    Cas No. 12629-01-5 Size: 15iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSN ...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    Quality Lyophilized Powder Lose Weight Powder AOD 9604 Hgh 176-191 99% Purity for sale

    Brand Name:Pharmlab

    Model Number:221231-10-3

    Place of Origin:China

    ...Lyophilized Powder Peptides Hormones Steroids AOD 9604 hgh 176-191 for weight loss Quick detail Product name: AOD 9604 Other Name: hgh 176-191 CAS: 221231-10-3 Appearance: white lyophilized powder purity: 99% Trademark...

    Pharmlab Co.,Ltd
    Verified Supplier

    Hubei

    Quality 2mg/Vial Fat Loss Peptide HGH Fragment 176-191 for Muscle Growthing for sale

    Brand Name:HBYC

    Model Number:HBYC

    Place of Origin:China

    ... Peptide HGH Fragment 176-191 for Muscle Growthing GH Frag 176-191 Quick Details: Gh Fragment 176 191 Product Name GH Frag 176 191 Gh Fragment 176 191 Synonyms GH Fragment 176-191 Gh Fragment 176 191 CAS...

    Hongkong YuanCheng GongChuang Technology Co.,Ltd
    Verified Supplier

    Quality No Side Effects Growth Hormone Steroid , 10 Iu Human Growth Hormone Drugs for sale

    Brand Name:SR

    Model Number:CAS 846-46-0

    Place of Origin:China

    ...No Side Effects White Power 10 iu HGH Human Growth Hormone / Hygetropin,Igtropin 1)Details Description : Product Name HGH CAS NO CAS106505-90-2 Apperance Lyophilized powder Delivery time Within 2 days after received payment Minimum...

    Shandong Shengri Chemical Co., Ltd.
    Verified Supplier

    Shandong

    Quality Pharmaceutical Raw Materials Nootropics Oxiracetam Powder Brain Metabolism Medicine No Side Effects for sale

    Brand Name:HKYC

    Model Number:62613-82-5

    Place of Origin:China

    ...Pharmaceutical Raw Materials Brain Metabolism Medicine Nootropics Oxiracetam NO Side Effects Quick Detail: Product name: Oxiracetam CAS No.: 62613-82-5 MF: C6H10N2O3 MW: 158.16 Appearance: ...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier

    Hong Kong

    Quality High quality bodybuilding Somatropin Cartridges Somatropin injection Human Growth Hormone HGH pen for sale

    Brand Name:YIHAN

    Model Number:hgh pen

    Place of Origin:CHINA

    ... that stimulates the growth of muscles and bones, helps regulate metabolism and influences sexual pleasure. HGH production slows down as you age. Jintropin from Gensci is the most popular human growth...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Guangdong

    Quality Growth Hormone Peptide Fragment 176-191 Top Quality HGH 191 amino acids HGH wholesale for sale

    Place of Origin:Shen Zhen of China

    Brand Name:Fragment 176-191 HGH

    Model Number:HGH-23

    ... peptide fragment 176-191, also known as HGH Frag 176-191, is a modified form of amino acids 176-191 of the GH polypeptide. Investigators at Monash University discovered that the fat-reducing effects of GH...

    Hongkong HW Biotech Co.,Ltd.
    Site Member

    Yunnan

    Quality Blue tops hgh Blue tops hgh Supplier Blue tops hgh 191-Aa Human Growth Hormone for sale

    Place of Origin:chemilytech@hotmail.com

    ...Blue tops hgh Blue tops hgh Supplier Blue tops hgh 191-Aa Human Growth Hormone We can supply them with High Quality,Low Price and Safe ...

    Humans Technology Co.,Ltd
    Site Member

    Hubei

    Quality Anti Hair Loss Somatomedin hypothesis Anti Aging HGH Without Side Effects for sale

    Brand Name:HGH

    Model Number:2iu/6iu/10iu/vial * 10vials/kit

    Place of Origin:China

    ...Anti Hair Loss Somatomedin hypothesis Anti Aging HGH Without Side Effects Description There are primarily two theories as to how hGH exerts its growth promoting effects. The first theory is called the Dual Effector...

    HongKong Amgen Biopharm CO.,LTD
    Active Member

    Hong Kong

    Quality green top hgh,hgh 191 blue top hgh,generic greentop hgh for sale

    Place of Origin:China

    Model Number:Green top HGH-01

    ...Inquiry and order email: hghseller at hotmail.com Product name : Green top HGH Price : 70-105$/kit(order more, better price) MOQ: 1 kit Specification: 100iu/kit (10iu/vial, ...

    Super Human Growth Hormone Pharmaceutical Co.,Ltd
    Active Member

    Guangdong

    Quality Fat loss and body building generics HGH 191 amino acid, improved heart and kidney function for sale

    Place of Origin:China

    Brand Name:Generics

    Model Number:10iu/vial, 100iu/box

    ...Fat loss and body building generics HGH 191 amino acid, improved heart and kidney function Competitive Advantage: 14% average decrease in fat 8.8% average ...

    Hongkong Super Hormones Bio-tech Co., ltd.
    Active Member

    Zhejiang

    Inquiry Cart 0